SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00492.1|PACid:22027859 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00492.1|PACid:22027859
Domain Number 1 Region: 172-310
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.0000000000824
Family FtsH protease domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00492.1|PACid:22027859
Sequence length 322
Sequence
MSVSVTSVVSLSNSSSTEFQTRISENQKNWRIKASSAAQGVDLKALELAITKKDSDAVRE
ALDQLNEIGWAKKWKSQPNVSRRTTFIRELTNLGIKNAENLAIPSVRNDAAFLFTVVGTT
GFLGVFAGQLPGDWGFFVPYLLGSISLVVLAIGSVSPGLLQAAIGGFSIFFPDYQERIAS
HEAAHFLVAYLLGLPILGYSLDIGKENVNLTDEKLQRLIYSGKLDAKELDRLAVITMAGL
AAEGLKYEKVVGQSADLFTLQRFINRTKPQISKEQQQNLTRWAVLLAGSLLKNNKSSHEA
LMSAMSKKASVLECIEAIESVV
Download sequence
Identical sequences A0A2G5DWM2
Aquca_014_00492.1|PACid:22027859 Aquca_014_00492.2|PACid:22027858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]