SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00588.3|PACid:22027508 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00588.3|PACid:22027508
Domain Number 1 Region: 56-307
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.1e-35
Family WD40-repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00588.3|PACid:22027508
Sequence length 315
Sequence
MLRNLLWATSKHDAYLMQNYSVMHWSSLHQRGKEVLNVAGSIVPTLKRPGSFSRSVSRVQ
ISTMAVKDNLLVAGGFHGELICKYLNRPGVAFCTKITDGENAITNAVDLYQASNGLTRLM
TANNDSAVRVFDTENFACISQFTFPWSVNNTSVSPDGKLFAVLGDNVNCLISDAQSGKVI
GNLKGHLDYSFASAWHPDGRILATGNQDTTCRLWDVRNTSQSLAVLKGRMGAIRAIKFSS
DGRFMAMAEPADFVHIYDTQADYNQDQEIDLFGEIAGISFSPDTEAFFVAVADRTYGSLL
EFNRKRGYQYLDSII
Download sequence
Identical sequences A0A2G5DX46
Aquca_014_00588.3|PACid:22027508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]