SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00745.1|PACid:22028210 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00745.1|PACid:22028210
Domain Number 1 Region: 113-368,406-430
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-37
Family WD40-repeat 0.002
Further Details:      
 
Domain Number 2 Region: 19-80
Classification Level Classification E-value
Superfamily F-box domain 0.000000000144
Family F-box domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00745.1|PACid:22028210
Sequence length 433
Sequence
MESNNYSGKKKCSSFSSSSLRRRSSIQSLDYNILSIIFASINHFDLVRCSSVCKSWYDCI
HTSDLLKMKYYNRNKDSCFLSNASSETTLKMYLKVLAMEQHRLSLQNGSADIYQWNGHSA
SIDQCRMKMGLILTGVGDKVARIWSVKSYKCLEEYSVPDMKPLADFDFDESKIVGLVGTR
ICIWRRNGKRSIFPSQDDAITTGLCMRYVDPEAVVGCGDGTARVFDMYSKKCSRIIRMHA
GPVTCLALTDDQLILSGSSLGSIKVAGLSSDQRVASLRSTHSTGIRSLCFNPSSSLVFAG
STGGYLHCWDLRTMKPLWENRISPNIIYSVQHMRNDTSSLVAGGIDGVLRILNQNTGELL
SSYVIREGTKAAASTKTGYGVVEKKKAEQLSEDACLDRIPKNSRPTITCLAVGMKKVVTT
HNSKLIRVWKFNN
Download sequence
Identical sequences A0A2G5DYL7
Aquca_014_00745.1|PACid:22028210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]