SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00784.2|PACid:22028021 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_014_00784.2|PACid:22028021
Domain Number - Region: 24-94
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.000196
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00784.2|PACid:22028021
Sequence length 132
Sequence
ATCCKTRMFRQRLQSVVKDVFQKKPINKIVTEARLLAQYCQERIALNQSKKVCSRYASEF
EKNLQENKDKIPVEAAEELEDAIASLKTVVDESDEKFGIAIRRLRRKVVDEKDKDKLFHL
LLDTNSKVQKYT
Download sequence
Identical sequences A0A2G5DY25
Aquca_014_00784.2|PACid:22028021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]