SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00801.3|PACid:22027672 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00801.3|PACid:22027672
Domain Number 1 Region: 119-388
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.38e-60
Family WD40-repeat 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00801.3|PACid:22027672
Sequence length 422
Sequence
MMEIDEQPMEMNNTIATTTTMNMNTFNNNVMCLLTDSEGTPLGAPMYLPQNAGPLQLQEI
VNKLLNNEEKLPYAFYILDKELVVQLGNYLEKNKVSVEKVLRIIYQPQAVFRIRPVNRCS
STIAGHIEAVLTVSFSPDGKHLASGSGDTTVRLWDLNTQTPLYTCTGHKNWVLCIAWSPD
GKHLVSGSKAGEILSWDPQTGKQSGKPFNGHKKWITGISWEPVHLRSPCRRFVSSSKDGD
ARIWDVTLRKCVMSLTGHTLAVTCVKWGGDGMIYTGSQDRTIKVWETTHGKLIRELKDHG
HWVNSLALSTEYVLRTGAFDHTGKQYSSPEEMKEAALVRYNKMKGNAPERLVSGSDDFTM
FLWEPFVSKQPKAQLTGHQQVNVILCFNFVFGFSKIQGLMMWKRIYIYIYIYIYIYIYYM
YR
Download sequence
Identical sequences A0A2G5DY97
Aquca_014_00801.3|PACid:22027672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]