SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_015_00052.1|PACid:22041849 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_015_00052.1|PACid:22041849
Domain Number 1 Region: 428-599
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.62e-27
Family hypothetical RNA methyltransferase 0.027
Further Details:      
 
Weak hits

Sequence:  Aquca_015_00052.1|PACid:22041849
Domain Number - Region: 191-221
Classification Level Classification E-value
Superfamily WW domain 0.000462
Family WW domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_015_00052.1|PACid:22041849
Sequence length 638
Sequence
MKKSKRKSSKVKPTLGHEDNTDGVVNVSKVGEVVSAINFLDKTNLSLCCISTLSPSETSY
SDIAEEVGKPHCSYNGGSVSMEEICEEITGVVENCGVDHDSVPCGVISNGNTEVAVNLIN
RDGEASLQNALQGSFVDIQLKGSLLSYYDSESAKLCVDTTTEEPYIPDSSVSSQSSLMKD
EYEIYKQCREFGDWRTFWDAFYLRNYFYNVKTHETTWNPPPGVEYKAFSEGEPKSLDLLV
DTAENDFMSELPTGDVPDPCDLQDTSQLFEKIISSNNSSGHSTHATTSGFELDAGTAIFQ
LDAATIYHSYQRSDKLDDINSQLVPAEDWENDPQKTPTNPETDGLDAYNYSDDQVLDVDR
LATTITKYSQENWKDIQLEYMAPLMDDFERQQVFVSGEMKKKKKKVRRTRTQTRLSEYKT
ELELEGMPQEVTDSIVKYWCQRYSLFSKFDDGIKMDEEGWFSVTPESIARHHAARCGGGI
VIDSFTGVGGNAIQLAKRGNHVIAIDIDPQKIEYAQQNAAIYGVDGIIDFINGDFFQLAP
KMKADTVFLSPPWGGPDYAKVQSYSIQTMLKPHDGHFLFKASRGIAPKIVMFLPRNVDIN
QLAELSLSAHPPWKLEVEKNFLNGKLKAITAYFSDTMV
Download sequence
Identical sequences A0A2G5DRY6
Aquca_015_00052.1|PACid:22041849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]