SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_015_00201.1|PACid:22042200 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_015_00201.1|PACid:22042200
Domain Number 1 Region: 10-244
Classification Level Classification E-value
Superfamily 14-3-3 protein 7.72e-100
Family 14-3-3 protein 0.00000000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_015_00201.1|PACid:22042200
Sequence length 252
Sequence
MASITEGNLSREQYVYLAKLAEQAERYEEMVSFMEKLVVGSASVNELSVEERNLLSVAYK
NVIGSLRAAWRIVSSIEQKEEGRKNDEHVVLVKDYRSKVESELTNVCAGVLKLLDAHLIP
SATTSESKVFYYKMKGDYHRYLAEFKTGAERKDAAEDTMLSYKAAQDVALADLAPTHPIR
LGLALNYSVFYYEILNSSEKACSMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTL
WTSDMQDQLDEV
Download sequence
Identical sequences A0A2G5DSJ7
Aquca_015_00201.1|PACid:22042200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]