SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_015_00213.2|PACid:22041931 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_015_00213.2|PACid:22041931
Domain Number 1 Region: 307-665
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.1e-118
Family Motor proteins 0.000000213
Further Details:      
 
Domain Number 2 Region: 200-308
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000628
Family Myosin rod fragments 0.018
Further Details:      
 
Weak hits

Sequence:  Aquca_015_00213.2|PACid:22041931
Domain Number - Region: 646-765
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_015_00213.2|PACid:22041931
Sequence length 803
Sequence
MFKTEDDITDAGDYPSIYQSARCGNFCYEFKDLLPGDYFVDLHFVEIICTNGPKGMRVFN
VFMQEEKVLSELDIYSIVGANKPLQLVDARVSVGENGTLVLRFEGVCGSPVVSGICIRRA
SKLALKTKAEYVVCNNCAAEIEVPQIKLLKSKAASRYEKKIQDLTHQCQLKTNECYEAWM
SLTAANEQLDKIRMELGDKLCQVHSLDQAMEKQTEKLKDVSDKYERDQRTWVAAIDNLDK
KIKIMKREQTQLSFEAHECADSVPELNKMVFAVQGLVSQCEDLKLKYSEEQAKRKKLHNQ
IQEAKGNIRVFCRCRPLSKEEISARYSTVVDFDAAKDGDLGVLTGGSTKKHFKFDRVFTP
KDDQVDVFVDASPMVVSVLDGYNVCIFAYGQTGTGKTFTMEGTEHNRGVNYRTVEELFKV
ANERSETFSYSISVSVLEVYNEQIRDLLATSQTSKKLEVKQASEGVHHVPGVVEAKVENL
KQVWDVLQAGSNSRAVGSNNVNEHSSRSHCMLCIMVKSKNLITGECTNSKLWLVDLAGSE
RLAKTDVQGERLKEAQNINRSLSALGDVISALANKSSHIPYRNSKLTHILQDSLGGDSKT
LMFVQISPSENDLGETLSSLNFATRVRGVELGPAKKQIDTGELQKMKTMLDKARQESRLK
DEALRKLEENLQNLESKARSKDQVCKNQQDKVKDLEGQLGSNIELHNQMEKQLWQTMEKL
KGKEEAYVRLQNKVKELENKIREREHSESMALQQKVKELENKLKERDQHQSECLFLQQKV
IAPLAWFYYVITSMLQKLNFVLL
Download sequence
Identical sequences A0A2G5DSM0
Aquca_015_00213.2|PACid:22041931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]