SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_015_00232.1|PACid:22041870 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_015_00232.1|PACid:22041870
Domain Number 1 Region: 115-327
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.00000000326
Family ATP-binding domain of peptide synthetases 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_015_00232.1|PACid:22041870
Sequence length 356
Sequence
MRLNGEISYRNDEDEEMKNERDSSLSCSIGADISQQKELVVGYALTSKKTKSFLQPKLEG
LARNKGISFVAIDQNKPLSDQGPFDIVLHKLSGKEWRRILEDYRQKHPEVTVLDPPDAIQ
HVYNRQSMLQDVADLNLSDNYGIVGVPRQLFIMKDPSAIPDAVAKARLTLPLVAKPLVVD
GSAKSHELSLAFDKCSLSKLDPPLVLQEFVNHGGVLFKVYIVGDAIKVVRRFSLPDVSKR
EMLSNTGVLPFPRVSCAAASADNADLDPAVAVFIDLAELPPRPLLEKLSRELRRRLGLRL
FNIDIIREHGTRDKYYVIDINYFPGLAKVPEYEHIFTDFLLSLVQSKFITHPAKSS
Download sequence
Identical sequences A0A2G5DSQ0
Aquca_015_00232.1|PACid:22041870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]