SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_015_00232.4|PACid:22041873 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_015_00232.4|PACid:22041873
Domain Number 1 Region: 115-318
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.0000000212
Family Lysine biosynthesis enzyme LysX ATP-binding domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_015_00232.4|PACid:22041873
Sequence length 320
Sequence
MRLNGEISYRNDEDEEMKNERDSSLSCSIGADISQQKELVVGYALTSKKTKSFLQPKLEG
LARNKGISFVAIDQNKPLSDQGPFDIVLHKLSGKEWRRILEDYRQKHPEVTVLDPPDAIQ
HVYNRQSMLQDVADLNLSDNYGIVGVPRQLFIMKDPSAIPDAVAKARLTLPLVAKPLVVD
GSAKSHELSLAFDKCSLSKLDPPLVLQEFVNHGGVLFKVYIVGDAIKVVRRFSLPDVSKR
EMLSNTGVLPFPRVSCAAASADNADLDPAVAELPPRPLLEKLSRELRRRLGLRLFNIDII
REHGTRDKYYVIDINYFPDP
Download sequence
Identical sequences A0A2G5DSP8
Aquca_015_00232.4|PACid:22041873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]