SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_015_00308.1|PACid:22042211 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_015_00308.1|PACid:22042211
Domain Number 1 Region: 439-518,545-734
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-58
Family Protein kinases, catalytic subunit 0.00074
Further Details:      
 
Weak hits

Sequence:  Aquca_015_00308.1|PACid:22042211
Domain Number - Region: 70-102,149-186
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0122
Family Quinoprotein alcohol dehydrogenase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_015_00308.1|PACid:22042211
Sequence length 829
Sequence
MKSSLWIFLLWFLLIIGGDFSSISMVLSNSEQQQQQQSQTADSTVIGKSLMQLKPSALKA
IFDQGPTLLVLQNGTIYFFGGKSKEHLWSFSAGASISSVYQAFPDDDGKENEYQQDAELL
PSPYGNLIDLGDATLQTKDSNELDLMNIVKDYVARAPVISKDEIRFGERKTMIKVLDAKD
GSLIDELNFLALPSGEKNGSVEMVYIVMKVYNLNSFAQVSHKMLWNLTVSEIQAVLYIQG
NMMPVPVVHIRDGAHYHFVLENLNHGDGELRVANNDIYSSSNLLSLIDDSKNLPSSSIVA
ISDSKSTSLATIETKDIRNENKNFDLRNIAKLAILCCLAILLLWGPWYIVKRQQSSKQLN
ELKGQKSIAKRKKTRKVGSSRKSVNNEKKDDIISGEGEDNKEYPKSVKDGHDSGFNLGIP
DTCSAKGRMVGTLFVSNIEIAKGSNGTVVLEGMSIGRPVAVKRLVQAHHDVAGKEIQNLI
LSDQHPNIVRLYGVERDSNFVYLSLERCTCSLYDLIQISSESSQPSDNYNFQLDSAKNIL
KDVELWKPNGHPSSQLLKIMREVIAGVAHLHELGIIHRDLKPQNILITKEKFLCAKISDM
GISKRLVGDNASLGHHPTGYGSLGWQAPEQILHGRQTRAVDLFSLGCVFFFCITGGKHPF
GDRHFEREANIIKHADQNHVDHNHVDLFMVEHIPEAVDLLSHLLDPKPEARPSTRHVINH
PFFWNSETRLSFFRDASDRVELEDRENDSDILKALENVAPTALGGNWDSKMEAVFITNIG
RYRRYKFDSMRDLLRVIRNKLNHYRELPKEIQVCVCSLHKLIIICSLSK
Download sequence
Identical sequences A0A2G5DT40
Aquca_015_00308.1|PACid:22042211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]