SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_015_00323.1|PACid:22041803 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_015_00323.1|PACid:22041803
Domain Number - Region: 25-145
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0314
Family DNA repair protein MutS, domain III 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_015_00323.1|PACid:22041803
Sequence length 198
Sequence
MEMLVKKYQQKYRKVREEMDRWDELQSRLLRQFRNASSIIERLEVLQNLKNYGALKSIVG
VREAILGKQMSSLEVILQSLKDTMQEFHAIDMSFEKILRDGKHLANGASRPLTEIQKQQR
IGIQPSIADCIEGLEKIYGMHHSEYHFKLSIVSSLMSKNPPPSASDFGALQQLLTDQPHI
PKEEVQSIFDIIFAEELC
Download sequence
Identical sequences A0A2G5DT56
Aquca_015_00323.1|PACid:22041803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]