SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_015_00343.1|PACid:22041623 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_015_00343.1|PACid:22041623
Domain Number 1 Region: 40-299,465-597
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.06e-24
Family WD40-repeat 0.021
Further Details:      
 
Domain Number 2 Region: 461-819
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.39e-20
Family WD40-repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_015_00343.1|PACid:22041623
Sequence length 1037
Sequence
MFVKKLVEKASKKSGVVKKNGIKASELNARLVFHNGIPSASISLAYDSIQNILAISTKDG
RIKLLGKDNTQALLVSNEPLPSKFMQFLDNHGVLFRVTVQNHIEVWDIETKTLAYVYMMN
EDITAFTVIQQTSYVYVGNSVGNVIVLKLDQVTNHLQQMNYNIPLSASHGNTSEVADDTA
VLHIMPLPKAESKRVLLIFRDGLIVLWGIEESKVLLVMGGNVLSLSNESKKVTSACWACP
FGSKLIVGYNTGEIYLWNVPSLSADMEIPSAQNIPSYKLNLSYKMEKIPILSLKWVYGDG
KCSRLYVNGFFNSSSSNMFQIVLLNEHTASRTIKLILPLLEPCLDMEIISSAFNQNKQNQ
NSLLLVLKSGRLCTFDDYAIEKYLLQNQSRSPPSLPKQVMLRLPFTDSTITVAKFITNDS
NFMSGINEDYNMLMKSFPALLPTEGRAKDGNSLSFVRFNGFSNIKNLYITGHSDGTINFW
DISCPLLIPISSVKQQSEDDHSLSGIPVTALYFDITSRNFVCGDQSGMVRIFKFKSEPFS
TESNLFSLQGNVKKGSNQIIQSIKLIKVNGAVISIDVNNHSKHLAVGTDQGYVSVIETEG
PTVLFQHHTTSEVCNSIMSVRFETCSFHGFEKKVLFIGMKDSSVLALESDTGNTLSTSTI
HPKKPARALYMQILDGSDSPNSSGANFVEDASHKQSFLLLCNEKTVYVYSLHHAVQGIKR
VVYKKKFHGTCCWASTFSNNSDVALALHFQGGKIEIRSLPELTLLKEISVRGLTIQNSKS
DSYSDNALCSSSDGELILVNGDQEVFFVSLLLRKEIYRFLDPISDVYQGMIAVEEEPISG
LTIHKEKKKGIFSSIMKDTKEKHTLETEVKNPAASTADELSNTFSIANFPLDNKISEQLV
VDEEDEVELNIDDIDIEDEKPKGNNMMAAINKQKITSKFMAIKGKLKQKMIKNEKGSAKA
EHEEEQADTVDQIKKKYGFASAVDPNAAKLAQNKLHENLRKLQGISLRATEMQGTAQSFS
AMASEVLRTAEKDKQIS
Download sequence
Identical sequences A0A2G5DT95
Aquca_015_00343.1|PACid:22041623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]