SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_015_00377.1|PACid:22042345 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_015_00377.1|PACid:22042345
Domain Number 1 Region: 379-622
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000000301
Family Galactose oxidase, central domain 0.039
Further Details:      
 
Domain Number 2 Region: 70-109,167-250,357-440,486-517
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000173
Family Quinoprotein alcohol dehydrogenase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_015_00377.1|PACid:22042345
Sequence length 656
Sequence
MDLLQKETCQHRKKAQFILWNIHTQNQIVLPSWNPNDFDICHHHFLSSPPTDPDCMVLSV
GEEFFLFWRQGDKKWTKQYYKIGDNDGVSSEYIDKLITSFNGTIYACTFQRNLVTIKRRH
CGTLSIRLLNIVEPQTFPPVFVSEYYIVESCGELYYVLLHYLPISEEINRVEIFKLNSSS
QIWIKVDCIGDAVFFLSNYTASMSLSVTNSEIKENQIYFTIPGDNNSLYVYDLEDESLIL
YLPCPNLQNSQSFLPYWLMHNSRLVERNKDDVKTTYEELKVEKSYNMVAAIQENVESTRP
DWTDLPLDVLRLSTTHIIFGTDYRNFRSVCKTWATSVPPNRWPTNKVGSATECPWLMFSN
RENITCSFLDPISSFTHCVNMPELMGAKICFSKDGWLLMSKGDHNIFFFNPFNNITIKLP
DLPVPFRFSGLSFSSLPTFPDCVVFCVNSSTYNEIDICYLHISAKAWVVRCFNNNVEMIL
SYSNPVFCDGAFYCLSQQKHLGVFDIKDGRCDWTNLSTPEPEPEPFSSLVRNYLVECNGE
LLSIHISHLGKGVSVYKLDRSSMKWAPLNSLEDRALFLSEAMSISLKAVDERMKNKIYFP
ISYNDTNNYVFYSFETRRWYSLFGDYCSEDIYNTREQLHCTWILPILSWKNDIQDS
Download sequence
Identical sequences A0A2G5DTL3
Aquca_015_00377.1|PACid:22042345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]