SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_015_00455.1|PACid:22042358 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_015_00455.1|PACid:22042358
Domain Number 1 Region: 252-496
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.84e-69
Family Extended AAA-ATPase domain 0.000000035
Further Details:      
 
Domain Number 2 Region: 506-700
Classification Level Classification E-value
Superfamily FtsH protease domain-like 8.63e-68
Family FtsH protease domain-like 0.00000787
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_015_00455.1|PACid:22042358
Sequence length 710
Sequence
MASTSNTLLSSSFFGTNLHLSPPTPKTSNSTLHLLSLSKRKSQTTKSNLNNEKTNSFSLK
NLPSQATLAALIFSSIPQTTHSALAIDTPPSSPQQVIQAEAIKSSSPFSQNLNLTAPKPQ
TSSDLPDGNQWRYSEFLNAVKKGKVERVRFSKDGGVLQLSAVDGRRASVIVPNDPDLIDI
LAMNGVDISVSEGETGNGLFNFIGNLLFPVLAFAGLFFLFRGQGGSGGPGGLGGPMDFGR
SKSKFQEVPETGVTFADVAGADQAKLELQEVVDFLKNPDKYTALGAKIPKGCLLVGPPGT
GKTLLARAVAGEAGTPFFSCAASEFVELFVGVGASRVRDLFEKAKAKAPCIVFIDEIDAV
GRQRGAGMGGGNDEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPGRFDRQ
VTVDRPDVAGRVKILQVHSRGKSLAKDVDFEKVARRTPGFTGADLQNLMNEAAILAARRD
LKEISKDEISDALERIIAGPEKKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISI
IPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDF
MQVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQMSSQKDYSMATADVVDSEVRELV
EKAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA
Download sequence
Identical sequences A0A2G5DTS7
Aquca_015_00455.1|PACid:22042358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]