SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_016_00019.1|PACid:22062414 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_016_00019.1|PACid:22062414
Domain Number 1 Region: 18-100
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.42e-22
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_016_00019.1|PACid:22062414
Sequence length 142
Sequence
MYTNYRNGEYTKTETKKTTIVWVGNRITPITDPFSSELKLLEDGNLVLLNKSKTTVWSTN
SASNVFNSSEAVLGDDGNLVLRNRVTPSNVFWQSFDFPTETWLLSARLSRLDKKKKKEGL
KEKTLTILIELNPNNRKRNPQF
Download sequence
Identical sequences A0A2G5DQ16
Aquca_016_00019.1|PACid:22062414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]