SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_016_00025.1|PACid:22062847 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_016_00025.1|PACid:22062847
Domain Number 1 Region: 98-172
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000816
Family alpha-D-mannose-specific plant lectins 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_016_00025.1|PACid:22062847
Sequence length 292
Sequence
MENNTTYKTNLVLFFFFSYALFVQAVAPAGTVERVTKQQLLASIPPSHESTPTGSSQLFL
TSPAGKYSVYLLRRESSIGAGGFGSDFCYVQVQDSGVSVWESECTTVSNVNTCSLVFSDA
GLEIFDGSRSAWDTDVEDDDAHIETLVLMDTGDMQIRNKDGDLKWRASDSPIVNQNCGSI
GAPDLNPAHPPFASPIHGGKGPFGQQNLGQQSSPLGFPQQPAADQGQQLGLGQQTLNQPF
SNAVNQAPFGVGGNQQPLVDNTPFDSGSSKVKLIEKGLVCLVGLMLCFGAVF
Download sequence
Identical sequences A0A2G5DPU1
Aquca_016_00025.1|PACid:22062847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]