SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_016_00065.2|PACid:22062888 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_016_00065.2|PACid:22062888
Domain Number - Region: 92-227,592-656
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00573
Family Quinoprotein alcohol dehydrogenase-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_016_00065.2|PACid:22062888
Sequence length 1234
Sequence
MNNNNNTSSSSSITNTTTDIIISSSSTTTSSSAVIKQDSETTITTTTTEEPLLPPQPVRV
FSPIKEKKEEIFIDKIMEDSSSIAIDEKENGGSGSISGLSLSNGGGGGGNGTPATVFQIS
LKQPKSNLRHKMSVPGLCRNFSAVSWCAKLNVIACASETCARIPSSRENSAFWIPIHIVN
PERPTECAVFNVIADSPRDSVQFIEWSPSSCPRALLVANFHGRITIWTQPAKGPANVIKD
ASFWQCEHEWRQDIAVVTKWLSWMSPYRWLSSNSSSSTFEEKFLSQQTQASARWPNFLCV
CSVFTSGSIQLHWSQWSPTQSSAGSKWFSTRKGLLGAGPSGIMTADAIITESGTMHVAGV
PIVNPSTVVVWEVTPGPGNECQVTMKSNMSTGVPPSINPPCWTGFAPLAAYLFSWQEYLG
SDGKQGIQNDQASSETISLHCSPVSNFSAYVSPEAAAQSTATTWGSAVTAVAFDPACSGS
VITVVIVEGQYMSPYDPDEGPSITGWRVQRWESSLKPVVLHPIFGTPASNFGGQAPMQTV
WLTRVNKSIIPSTQMKSFRPSTTASSEQNMSDSVTEKVDRLSFDPCDLPSDVRALARIVY
SAHGGEVVVAFLEGGFHIFSGENFTPVENCHVCVGSAVAAPSFSSTSCCLAYVWHNTEKD
CTMLKIIRVLPPAIQSSEAKVNSATWERALADRFWWSLLVGVDWWDAVGCTQSAAEDEIV
SLNSVIAVLDADFHSLPSIHHRQLHGPSLDKIKCRLLEGTNAQEVRALVLDMQARLLLDM
LGRGIESALINPETLVSEPWQASGEMLSGIDPNAMTVETALVPSIQAYVDAILDLASHFI
TRLRRYASFCRTLASHAVGASAGTVSNRNMVTSPTHSSASPSTTQGGQNGTTSSTGSSQM
QAWVQGAIAKISGTADGVSSSTPNPMSGPSPLMPISINTGTFPGTPAVRLIGDCHFLHRL
CQLLLFCFFFWRKQLPRFIGGVQKNSQLIGPGKVEDSHGNSTRATSGMLRPEEVQAARSG
QLVHGSKGVEEGPAGRSQRFGFGNGGQGYNFEEVKVLFLILIDLCRRTASLAHPLPVSQV
ASSNIQIRLHYIDGNYTVLPEVVEASLGPHMQNMPRPRGADAAGLLLRELELHPPAEEWH
RRNMFGGPWSDAEDLDDTPKLSGSSNLFEVTASEDLDSYYGSQGLWPRKRRLSERDAAFG
LKTSVGLGEYLGIMGSRRDVVTAVWKTGLRGICA
Download sequence
Identical sequences A0A2G5DQ12
Aquca_016_00065.2|PACid:22062888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]