SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_016_00141.2|PACid:22062961 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_016_00141.2|PACid:22062961
Domain Number 1 Region: 170-399
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.98e-34
Family WD40-repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_016_00141.2|PACid:22062961
Sequence length 402
Sequence
MASQPLTEYERKRLENIKRNAEMMASLKLQSKAVELNSAIKRDRIEKKGYKITPDKKPKS
ETPVIMRRSLRTRGLPPDPSTAKGLEDDQMPAPLKTPSTIPSKVPIARLGPLSFEEAYIG
DSYDRVLIDSVMDMLDNTSLGKKGLVGSGGSFDLDSMVLKEENIARVMPGKILHLRFFPC
DDRSMIVAGNKFGNIVFWDVDSEGSDGIYLYQPHTAPISGISIQPFNLSKVFSSCYAGLV
RLLDFEKESVDLVHSSDNVIFSLSQRPQDANSVYFSEGHGLLNVWDTRAGKSSRSWVLHD
DRINTIDFNPENTNLMVTSSTDGSACIWDLRKINAGRPKNLMVVNHKRAVHSAYFSPTGN
CLATTSIDNNVGIISGADFMDKSVVYHNNQTGRWISSFSFYQ
Download sequence
Identical sequences A0A2G5DQA6
Aquca_016_00141.2|PACid:22062961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]