SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_016_00147.1|PACid:22062891 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_016_00147.1|PACid:22062891
Domain Number - Region: 5-25,52-143,224-268
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0011
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_016_00147.1|PACid:22062891
Sequence length 288
Sequence
MCRSTGNWLITVNEEQQVYIFNPFTRIQFQLPSHSALPDQYDCDFNQEELCGRFLRKVVL
SSPPTYMNSNLDDVVVIACYGTKKRLAIARPGDKSWTPIKRYIPADMLVDDIIFFKNRFY
FVNREGYVAYYDISCDPLVATYVSGEFTTVRYVHRFYLVEWMGELLLVRKYIPRRGKESY
YRTEGFQVSKFNFDNGEWEEVKSLGQHSLFLGFNTSVSLLASNSSTFRGNCIYFTDDYML
GYIGNGIEGGSDKGVFDLKDGTIKPHYAGISTSLYSPPLWIIPKSLHQ
Download sequence
Identical sequences A0A2G5DQD7
Aquca_016_00147.1|PACid:22062891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]