SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_016_00151.1|PACid:22062759 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_016_00151.1|PACid:22062759
Domain Number - Region: 51-93
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00385
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 92-133
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00732
Family Polyphosphate kinase C-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_016_00151.1|PACid:22062759
Sequence length 180
Sequence
MLLLLDLHLPFTFIIFTSSYSSPTTTISCSNHSSTCKSFHREIEIEHHILVFLSKFGLKS
HNGCLHAKHQVLCKECGNVFLDYIDLNDHVKKHHTKLHLVFHSYMLSGTMSLNDTSIDIN
MNFGFSFADRYIVTCKALCASAKLVHMDQILFDFCQVSSYRSECVRVGSYFVQLEVTSSN
Download sequence
Identical sequences A0A2G5DQD2
Aquca_016_00151.1|PACid:22062759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]