SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_016_00224.1|PACid:22062859 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_016_00224.1|PACid:22062859
Domain Number 1 Region: 6-98
Classification Level Classification E-value
Superfamily POZ domain 9.42e-22
Family Tetramerization domain of potassium channels 0.0044
Further Details:      
 
Domain Number 2 Region: 122-313,342-433
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000439
Family Quinoprotein alcohol dehydrogenase-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_016_00224.1|PACid:22062859
Sequence length 442
Sequence
MGIQKDRIKFNVGGKIFETSATTLANAGRNSLFGPMFDDNWNLQSMESNDEYFIDRNPAC
FAVLLDLLRNGELHVPAKVPEKLLYREALYYGLLDHVRAAKWGQFDGNRLRLCASITGRA
PGDGTAIRAGPDGGCCVAHGSMVHVYDWMLEEHPTINLDYQRVNDIGWIDSENIVISACE
RLGKGDGGMGLFSSSSGELRYKFHVSHEDQVKSYTAGALSFSSDYKIFASCKGRSNEYGI
GVWDQVTGKQIDFFYESPGWSLGDADRLQWLNGTNCLLVASLFPRKDNCYISLLDFREKR
MVWYWSDIGAPVTIDEKRVRDAIAMEESSSICVVNEYEDLGFMDLRSTVGSVRWSSRSRL
LTGKMPEEPCYPKLALHGGQLFSSMNDCVSVFSGPDCVLTSRLRRSYGGSICDFSIGGER
LFALHSEENVFDIWETPPPPIM
Download sequence
Identical sequences A0A2G5DRG9
Aquca_016_00224.1|PACid:22062859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]