SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_016_00229.1|PACid:22062496 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_016_00229.1|PACid:22062496
Domain Number 1 Region: 15-93
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.96e-27
Family eIF5a N-terminal domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 86-155
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8e-26
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_016_00229.1|PACid:22062496
Sequence length 159
Sequence
MSDEEHHFEAKGDAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF
VAIDIFTAKKLEDIVPSSHNCDIPHVNRTDYQLIDISEDGFISLLTENGNTKDDLRLPTD
DGLLTQIKDGFAEGKDLVVTVMSAMGEEQICALKDITKS
Download sequence
Identical sequences A0A2G5DQP2
Aquca_016_00229.1|PACid:22062496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]