SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_016_00254.2|PACid:22062784 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_016_00254.2|PACid:22062784
Domain Number 1 Region: 37-144
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.000000000053
Family Succinyl-CoA synthetase, beta-chain, N-terminal domain 0.0016
Further Details:      
 
Weak hits

Sequence:  Aquca_016_00254.2|PACid:22062784
Domain Number - Region: 158-189
Classification Level Classification E-value
Superfamily Fumarate reductase respiratory complex transmembrane subunits 0.085
Family Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_016_00254.2|PACid:22062784
Sequence length 197
Sequence
MMRGLINKLASSKSLSVIGKWQLQQQQIRRFNIHENHQGAELMGKYGINVPSSEQVKKAI
QDVFPNQNEVAVKSQVLAGGQGLGTFKSGLKAGGVHIVKSNELEDIAGKMLGQNILVTKQ
TGPQGKVVSKAFEKKYVNKFQEMAPMVLSTYRNSGQEGIKEIMADYVHHEMTRNLFLIYF
TLFRFIVIKDVYLFLVS
Download sequence
Identical sequences A0A2G5DQT0
Aquca_016_00254.2|PACid:22062784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]