SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_016_00366.1|PACid:22062470 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_016_00366.1|PACid:22062470
Domain Number 1 Region: 49-101
Classification Level Classification E-value
Superfamily F-box domain 0.00000102
Family F-box domain 0.0066
Further Details:      
 
Weak hits

Sequence:  Aquca_016_00366.1|PACid:22062470
Domain Number - Region: 139-275,324-364
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0183
Family WD40-repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_016_00366.1|PACid:22062470
Sequence length 421
Sequence
MDWLKKKKIVLDYVHFTWITLVCWIRILSGNLPCFKSSNDVLLLENNNKDYVDWLQLPED
VLSEIPFKFIDIIDNIRFGAVCHTWRSVYIDNNRFHHLPRQPPLLMLATQLNLDDQTRSF
YSLVEKKVFNFQVPVPHNLFISGSSYGWLVTVSETHQVSLFNPFASVNNEIKLPPLTTFE
IVGNDDAVFTWGFRSFLFKVVLSANPTSNPNYVAMAIYAASCSLAFYRPGDKAWTLLPSE
FCAEDIIYFGDQFYIISAQGEVYTCDLNDPQPSLSSVAPPLGLVPYKRYLVESSGELLQI
LRYMDYNEDEDAEGYYFNDGFYVFKLNPINLKWIKIDSLQGRVLFLGNNSSYAISAFDFP
RCKPNTIYFTDDYYEGYFEKEKFGPHDIGVFNIEDRTLEQHYPITSNTVFPAPIWVEPLL
Y
Download sequence
Identical sequences A0A2G5DRA2
Aquca_016_00366.1|PACid:22062470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]