SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00014.1|PACid:22032483 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00014.1|PACid:22032483
Domain Number 1 Region: 479-718
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.83e-20
Family WD40-repeat 0.0078
Further Details:      
 
Weak hits

Sequence:  Aquca_017_00014.1|PACid:22032483
Domain Number - Region: 8-57,85-118
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00733
Family WD40-repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00014.1|PACid:22032483
Sequence length 1095
Sequence
MVSPFQTATLVARPSYPNSIAWSHENLVAIASGHLITILNPALLFGPRGLITIPPIKPFP
IGVVSREDLLTECLLPTCLSRDTRPCARSIAWSPLGLAPNSGCILAVCTTEGRVKLYRQP
FIEYCAEWVEVIDITDLLFDHLVRSGFGEADLPFTKASCEEAAECQRESACGSHLKNSML
NKGHKRRGTMEDQVSYFETMEDANGSCTPFNEKRVTARTETAAFHCLFKKNTCVEVLKQN
GPQLVWVNGTIERIRNGKALVHFSGTRISGTLLNDDWVELNIKKGKMRSSHAQNGINPDP
AALSPKIRPYMDVANLPEQIVLLEYPDLERILSGQAVEAWLDDRWVEGLCVGFSEQGLLV
KLSGESGSVTLDARSVRLAPLWNCGLNLWQVTIPKIEMEDLELAKVVKSKTKRFKENNLR
RCSSVPKHQGKSDKQRSVNGTISEITARQYVSCNAMLSSTVVAWSPMLHLSSESDSSHLN
SSPSDLSLLSVGGKSGKLSLWRIYEPQRYSIVHNDVSVNVSLVGLLQAHNKWITSICWKS
LSTNGSNSQVALATGSSDGSVKVWLVDTERLLNSSESNNSSICLLKEVTSASSAPVSVLS
LTASAESPEKMLLAVGRGSGSLEVWICDISNFKFQIIGSYDAHVQVVTGLTWAFNGHCLY
SCSQDDSVRSWVIQGSSLYEAQIPSGSLGIRSSTDLPNVSDSCFGLAISPGNLVIAVVRG
LDTELLNQMYQARSQKAAVEFCWIGGQQLESSSDKNLELGVETIPGISEREMACWESNML
WSLKQYQHLDNLLVVWDVIVALFAVEYSAQNYVQRILAKWLSSWFAGCDVGCSIEKILLY
ASRCLYKISTRQLHLLNIICRRFVLSGLKGDIPNVQAMLLEGVGVEDERLKLWIDILDIS
ERELRERLVAFSFAFLLSQASSSTTIIPIDRQWLPAGIAQMEQWVAKNHDSVQDNLKILA
SKLEKLGKRLHSICGYVAEEQCKFCSASAPFDSPEIAFCVGVSCNTGVGQSHKLVRCAAS
MQLCPTTPLWYCVCCQRFVSELAPRSLFTLSELPIDLKSFMRSSSRQLALRPLCPFCGIL
LQRLQPEFLISPSPV
Download sequence
Identical sequences A0A2G5DKR6
Aquca_017_00014.1|PACid:22032483 Aquca_017_00014.2|PACid:22032482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]