SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00115.2|PACid:22031525 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00115.2|PACid:22031525
Domain Number 1 Region: 373-632,844-962
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.92e-45
Family Quinoprotein alcohol dehydrogenase-like 0.037
Further Details:      
 
Domain Number 2 Region: 921-1119
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000000000000463
Family Quinohemoprotein amine dehydrogenase B chain 0.049
Further Details:      
 
Weak hits

Sequence:  Aquca_017_00115.2|PACid:22031525
Domain Number - Region: 342-381
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000348
Family WD40-repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00115.2|PACid:22031525
Sequence length 1142
Sequence
MTSLSRELVFLILQFLDEEKFKDSVHKLEQESGFFFNMKHFEERAQAGDWDEVERYLSGF
TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFSTFNEELLKEITQLLT
LDNFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLVFPTLKQARLRTLINQSLN
WQHQLCKNPRPNPDIKTLFTDHSCAPTNGTRAATPVALPVGAVAKPATYANLGVHGMQPF
PPPTAAAANANALAGWMANATASSSVQSAVVAASSIPMLQNQGSIVKRPRTPPTSLGMVD
YQSAEHEQLMKRFRSAAQPINDEASYPGPHQNVSWTMDDLPRTVVCSFHQGSSVTSIDFH
PSHHTLVLVGSANGETTLWDIGLRERLVSKPFKIRDIEACSLPFQTSYLKDSTISITRVA
WSPDGNLMGVAFSKHLIHLFDCQGPNDLRQLLEIDAHVGSVNDLAFSYPNKQLCVVSCGD
DKQIKVWDLTGRRLYNFEGHDAPVYSVCPHHKETIQFIFSTATDGKIKAWLYDNMGSRVD
YDAPGHGCTTMLYSADGTRLFSCGTSKEGDSFLVEWNESEGAIKRTYSGFRKKSAGVVQF
DTTQNRFLAAGEDHQIKFWDMDNTNILTSTEAEGGLASLPRLRFNKEGNLLAVSTADNGF
KILANTEGLRSLRVFGRSIEGLRLHNEASAVKIPGPSAVANVSPAISKVERLDQTSPARP
SPVCNGGDPSIRSVEKTRTLEDAPDEGKFRELTEIVDPLKCRVVTMPDSADASNADPASK
VARLLYTNSGGGILALGVNGMQKLWKWSRSERNPNGKATASIVPQQWQPNSGLRMNNDIS
DVNLEEAVPCIALSKNDSYVMSACGGKISLFNMMTFKVMTTFMPPPPAPTFLAFHPQDNN
IIAIGMEDSTIHIYNVRVDEVKTKLKGHQKHITGLAFSTNLNILVSSGADAQLCTWNTDT
WEKRKAITIEVPAGKVAIGDTRVQFHSDQIRLLVFHETQLAIYDASKMECIHQWIPQEVL
SAPISYAAYSCNSQLIYAAFCDGNVGVFDAENLRLRCRIAPSAYLSQAVLNSQNMRPLVI
ATHPHEPNQLAIGSTDGTVKVIEPSESDGSWIATAPSANGLLNGRTAASSATIKRDPEQL
QR
Download sequence
Identical sequences A0A2G5DLC1
Aquca_017_00115.2|PACid:22031525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]