SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00141.1|PACid:22032555 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00141.1|PACid:22032555
Domain Number 1 Region: 269-504
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.56e-68
Family CAT-like 0.00000781
Further Details:      
 
Domain Number 2 Region: 87-166
Classification Level Classification E-value
Superfamily Single hybrid motif 4.32e-22
Family Biotinyl/lipoyl-carrier proteins and domains 0.00027
Further Details:      
 
Domain Number 3 Region: 195-240
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.00000000000196
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00141.1|PACid:22032555
Sequence length 507
Sequence
MIWRRILRNSGARFGCAYSTTTCTKRAPLLEISSSSSEQKNPFLGFCSQLIVSQSISSGS
FNLNKAFTTKKCFFSTQGSVDLPVGEIIEVPLAQTGEGIAECELLKWFVQEGDLVEEFQP
LCEVQSDKATIEITSRYKGRVFEILYDSGDIVKVGETLLKMVFDESCISMLPSDDLKTPL
PLFSETCDTSNQIPLHSEQAVQATPAVRNIAKQFGIDINVVHGSGKNGRVLKEDVLNYAA
SRGMCEQPSTLSTDQLLLQEDIPLHILSKEGFHFEDKTVSLRGFQRAMVKSMTMAAKVPH
FHYLEEINCDALVELKTVFQKQNSDPNIKHTYLPFLLKSLSTALSKHPLLNSSFREESYE
VILKGSHNIGVAMATPHGLVVPNIKKVQSLSILEITKELSRLQQLALNNKLNSEDVSGGT
ITLSNIGAVGGKFGCPLLNLPEVAIIAIGRIQKVPRFTDDGSLYPASIVNVNIGADHRVV
DGASVARFCNDWKLLIEKPELLMLQTR
Download sequence
Identical sequences A0A2G5DLH3
Aquca_017_00141.1|PACid:22032555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]