SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00229.1|PACid:22031927 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00229.1|PACid:22031927
Domain Number 1 Region: 320-438
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000000872
Family UbiE/COQ5-like 0.031
Further Details:      
 
Weak hits

Sequence:  Aquca_017_00229.1|PACid:22031927
Domain Number - Region: 61-119
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0785
Family Myosin rod fragments 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00229.1|PACid:22031927
Sequence length 470
Sequence
MGRFCFPKCRLSRVMGSLQVLLGGLVIIVSITSLFRFYSAGFFMHDDDICRHFYGVKDAY
SYESFDVKALSDRVEEVVSKMANLQRKLESTVQQMEKNKEELDKTSVSKSEYKKFLEEEV
IKPLYSAHISLRQIRLPRVEGVGNITLKEDPLINSFTIEEIRKYITPKKNRIGKISIYGT
ERTYNTIGHACVLMKKELEEYMDYDIGSYCKDDWNLAQKLMLNGCDPLPRRRCLTRASKL
YQKPYAINESLWKIPDYRNVRWNNYVCRNFDCLSSKNPKRGYSKCTGCFEMDKERVKWVS
NSSLPVDFLITDVFTIKPGEIRIGLDFGIGTGTFAARMREHNVTIITTALNLGAPFNEMI
ALRGLIPLYVTLNHRLPLFDNTMDLIHTTGFLDSWIDLQLMDFILFDWDRILRPGGLLWI
DKFFCHRKDLDDYMYMFLQFRYKKHKWVISPKSKEEVYLSALLEKPPRSL
Download sequence
Identical sequences A0A2G5DLV0
Aquca_017_00229.1|PACid:22031927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]