SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00355.2|PACid:22032172 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_017_00355.2|PACid:22032172
Domain Number - Region: 57-141
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00204
Family Myosin rod fragments 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00355.2|PACid:22032172
Sequence length 347
Sequence
MLAKESAVPTFDLPEEVLSILPSDPFEQLDIARKITSIALATRVSKLESESSFLRSKLDE
KEEQLAVLQSQIESLDASLSETSDKLAQAHEEKERLLKENASLSVTVRKLNRDVSKLEIF
RKTLVQSLQEEEESAGGVAQAVAKQIQANPSFAPEEDGSLPPSKSSSFRSQFSDTRDSSK
EDSGSAETDGYRYGTSQGPLLASYSSTPRLTPPITPPTLSAAATPTRRSKPGSPRRHSIS
FANSRGVYEDRTSVFSSLPPSHHSSISSSMDMASQTGRTRVDGKEFFRQVRSRLSYEQFG
AFLANVKELNSHKQTREETLRKADEIFGPENKDLYVIFEGLITRNVH
Download sequence
Identical sequences A0A2G5DMF8
Aquca_017_00355.2|PACid:22032172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]