SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00378.2|PACid:22031200 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00378.2|PACid:22031200
Domain Number 1 Region: 84-281,385-449
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.41e-81
Family Eukaryotic glutathione synthetase ATP-binding domain 0.0000348
Further Details:      
 
Domain Number 2 Region: 284-387
Classification Level Classification E-value
Superfamily PreATP-grasp domain 5.75e-37
Family Eukaryotic glutathione synthetase, substrate-binding domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00378.2|PACid:22031200
Sequence length 474
Sequence
MGVGYICCTSSSSSSSTLLTYKPKQLFNLANPTTTSITSQSHFKTSTNFYSISCTSSSFL
PLKCGAGIDIRETQDENTSNPMMGIHNINPDLLQQMVYDALVWCSLHGLVVGDKSVQNSG
IVPGVGMKHAPFALLPTSFPQTQWQQACDLMCIFNELIDRVSLDGNFLQDTLSRTKRVDV
FTSRLLDIHSMMLEIKKKEEIRLGLHRSDYMLDDQTKDLLQIELNTISSSFPGLGCLVSE
LHSNLLNHYGDHVGLQSGRVPGNTALTGYADALGQAWKEYNDPRAVVMVVVQTEERNMYD
QHWLSTVLKERHAVTTIRKTLAEVDSEGELLPDGTLLVGGQKVAVIYFRAGYAPSDYPSE
SEWEARLLMECSSAVKCPSISYHLAGTKKIQQELAKPNVLERFLENKDEIAKLRKCFAGL
WSLDDPHAVRDALERPELYVLKPQREGGGLVISDLFHLILLISNSCCFSRKKIK
Download sequence
Identical sequences A0A2G5DMK0
Aquca_017_00378.2|PACid:22031200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]