SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00511.1|PACid:22031684 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00511.1|PACid:22031684
Domain Number 1 Region: 10-110
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 6.52e-32
Family Ribosomal proteins L24p and L21e 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00511.1|PACid:22031684
Sequence length 159
Sequence
MGWKAAQKLIQNWKILRGDNVMIMRGKDKGETGVIKRVIRSQNRVLVEGKNLVKKHIKQG
QGHEGGIFTVEAPLHVSNVQVLDPVTGKPCKTGVKYLEDGTKVRVARGNGTSGSIIPRPE
ILKIRTTARPTTAGPKDTPIELVLEKTYDAKTGRGMPSL
Download sequence
Identical sequences A0A2G5DN93
Aquca_017_00511.1|PACid:22031684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]