SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00531.1|PACid:22031817 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00531.1|PACid:22031817
Domain Number 1 Region: 498-804
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-78
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 92-182
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.32e-20
Family alpha-D-mannose-specific plant lectins 0.0056
Further Details:      
 
Weak hits

Sequence:  Aquca_017_00531.1|PACid:22031817
Domain Number - Region: 296-331,379-405
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0022
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00531.1|PACid:22031817
Sequence length 876
Sequence
MDSNLFFSFTTTLLIIIFFHVSYFPLPSFSLRIYSEFIYPNFTTSNLQYVSNTGAFLTSQ
RTTFKAAIIHHEPSEEVADFYFSIIHVESNQIIWSANRDSPISNSDKFSLTSNGFSLVRE
NGQRIWSTPPFNSSVRALQLQESGNLVLIDNFNRTIWQSFDHPTDTIVVGQRLPVGTLLL
SGLQNNVLTGNYSFMLIDHDAVLQWNSDTYWKISMDTSTFKDKNSPVAYLMLNGTGLYLC
GYANVVVFQVILNYSTAFRVAQLNYDGRFTIKSFLNKQWTQEFVGPQKDCLIPNFCGAYG
LCTEAVAGSNSGTCTCPSGFRSKTGTRSCLPPNASSLPPACGNGTRLSSSQMVSYEELST
GIDYFSNAFSTPILSGQDLLACANICSRNCSCLGYFYENSSGSCYPLNNQLGSFLTVDGQ
TDRKGYIKTIVSANNKNEKKGKNPPIVALVLIPTTAVSLLAILIVVGLFAWRKSRSKKTK
EVKLGRPSSNNSVEIDTFSIPGLPVRFDYEELDKATNNFQNKIGSGGFGDVYKGTLSDKT
TVAVKKITNSSNQGKKEFCTEIAIIGNIHHVNLVKLRGFCAQGRQRLLVYEYMSRGSLDR
TLFGSGPVLEWQERFEIAMGTARGLAYLHSGCEQKIIHCDVKPENILLNDHFQVKISDFG
LSKLLSPEQSSHFTTMRGTRGYLAPEWLTSSAISDKTDVYSFGMVLLEIVSGRKNCSTKT
QTHSIEIDSGSGGDSSSSTVSIPLYFPLYALEMHEERRYKELADPKLEGRVRNEEVEMLV
RVALCCVHEDPSLRPSMANVVSMMEGGIPLGTPRVEGLNFLRFYGRRFTEASNIEGSNVG
NVFALFPQAMASSESTTTGSYGSLSYMSSQQVSGPR
Download sequence
Identical sequences A0A2G5DNG3
Aquca_017_00531.1|PACid:22031817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]