SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00553.1|PACid:22031729 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00553.1|PACid:22031729
Domain Number 1 Region: 2980-3267
Classification Level Classification E-value
Superfamily BEACH domain 3.27e-122
Family BEACH domain 0.0000000185
Further Details:      
 
Domain Number 2 Region: 3320-3522,3551-3603
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.76e-32
Family WD40-repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 2788-2831,2901-2953
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-17
Family PreBEACH PH-like domain 0.032
Further Details:      
 
Domain Number 4 Region: 1135-1283
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000095
Family Laminin G-like module 0.052
Further Details:      
 
Domain Number 5 Region: 493-635,689-728,779-819,932-999
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000384
Family Armadillo repeat 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00553.1|PACid:22031729
Sequence length 3605
Sequence
MFQSSRKTMKWTTLLKDIKEKVGLSNSSHSNLHPSSNSSSPSSSGHSIPTSAENDFSASP
ARDKHELELDFKRFWEEFRSSNSEKEKEAALNMAVDVFCRLVKQKANITQLVTVLVEAHI
FSFVVGRAFVTDIEKLKITSKARSLDVGKVLCFFSDVSKDGFCPGSNLLYAVEVLVSGPI
DKQSLLDSGILCCLIRILNALLNPDGTNQQQVASNSEESFLGGKGQGGDVGQIRRLEVEG
SIVHIMKALAGHPSAAQSLIEDDSLELLFHMVATGSVTVFSRFREGLVRLHTIQLHRHAM
QILSLLLVNDSGKTAKYIHKHHLVKVLLMAVKDFNPDCGDPAYTMGIVDLLLECVELSYR
PDAGGIRLREDIHNAHGYQFLVQFSLLLSTLKTHQGIQSKSADGISASDASSTSNSVGKQ
EFKDRGDSSLSHLSPSLSRLLDVLVNLAQTGPNEHTVSVGGKGSKSTYGKASGHSRSSIS
SSERLGDEAWEKDKTKVKDLEAIQMLQDIFLKANSTELQAEVLNRMFKIFSSHLENYKLC
QQLRTVPLFILNMAGFPPSLQDIILKILEYAVTVVNCVPEQELLSLCCLLQQPITPDLKH
TILSFFVKLLSFDQQYKKVLREVGVLEVLLDDLKQHKFLSGSEQHSKTPGELEMKSSSSS
FKKHMDSKDSIISSPKLLESGSGKFPLFGIEDTISVAWDCMVSLLKKAETNQSAFRSSNG
VTILLPFLASDIHRSGVLRTLSCLIVEDVTQAHSEELGALVEILQSGMVSSVSGSHYKLQ
GDAKCDTFGALWRILGVNSASQRVFGEATGFSLLLTILHSFQSDGQVDDQSVLTHMKVFT
FLLRVVTAGVCGNSVNRTRLHTVISSQTFYDLLSESGLLCVDCEKQVIQLLLELALEIVL
PPSCLLTSESGPSSDMAEAGSANFLLSAESGSFSPSKERVYNAGAIGVLIRCLLLFTPKV
QLDLLSFIGKLAHGSPFNLENLTSIGCVGLLLDTICPFLLGSSSLLTHALQIVEVLGAHR
LSSSELRVLVKYILQTRQMNSGHALVAMMESLIRMEDMKAQNVSLAPYVEMDMSKFGHAS
FQVSLGDRSWPPAAGYSFVCWFQYRHFLKPAVKEIEQPLKTGHKRRSTSSRQQRGHVLRL
FSVGSPDDGNTHYAELYLQDDGVLTLATSNSCSLSFSGSELEEGKWHHLAVVHSKPNALA
GLFQASVAYLYLNGKLRHTGKLGYSPSPLGKSLQVTVGTPISCARVNEVSWKLRSCYLFE
EVLTSGSICFMYILGRGYRGLFQDTDLLRFVPNQACGGGSMAILDSLDAESPLASNMQRI
DSGGKQNNLKTDGSGIVWDADRLRNLSLQLSGKKLIFAFDGTLSEAYRASGTASMFNLVD
PTSAAASPIGGIPRFGRLHGDSYICRQYVIGDCIRTVGGMTVVLALVEAAETRNMLHMAL
ALLSCALHQNPQNVRDMQAYRGYHLLALFLHRRMPLFDMQSLEIFFQIAACEAAVSEPQK
TQEIHAIPSPGGVNHENSYEHLSLSKFPDELSSVGSHGDMDDFSVQKDSLSHMSELENND
MSAETSNCIVLSNADMVEHVLLDWTLWVTSPVSIQIALLGFLERLVCMHWYRNHNLTVLR
RINLVQHLLVTLQRGDVEVPVLEKLVVLLGVILEDGFLSSELEQVVRFVIMTFDPPKMIA
RNQIIRETMGKHVIVRNMLLEMLIDLQMTINSEELLEQWHKLVSSKLITYFLDEAVHPTS
MRWIMTLLGVCLASSPTFSLKFRNGGGYQGLTRVLPSFYDSPEIYYTLFCLIFGKPVYPR
LPEVRMLDFHALMPNGNSGDLKFVELLESVIAMAKSTFDRLRTQLMLSYETGNLSQVSAS
LVAELVEETTDMMGELQGEALMHKTYAARLMGGEAAAPAAAMSVLRFMVDLAKMCPPFSA
ICRRAEFLESCVDLYFSCVRAACAVKMAKKLSVSIEEKNLNDSDDTHSSQNTFSSLPHEQ
EQSKTSISVGSFPQGQISTSSEDMLEPQNYSVHDKAEDKATPSQKELNKPLLNGGAVLNS
DGESFDQASKVTSSGNEMKFSRANGLLAGDHAKESLSSSSLSVPESPMLSEKSVPKVPLV
PPASPVIALTSWLGSASQSEVKSPSLSTPSMRSSVSVSESDASHDIKSQSQGLSASNTFF
ALNPKLLLEIEDSSYGGGPCSGGATSVLDFMSEVLADIVTEQLKATQIIESILETIPLNV
DVECALIFQGLCLSRLMNFLERRLLRDDEEDEKKLDKTRWSLNLDQLCWMIVDRVYMGAF
PNPSAVIGALEFLLSMLQLANKDGRIEEAAPSGKGLLSITRGTRQLEAYVHALLKNTNRM
IMYCFLPSFLNTIGEDDLFSSIVLQEPKKVAYLNSSHEKSGTDICTVLQMLIAHKRIIFC
PTNLDTDLNCGLCINLISLLRDQRRIAQNLAVDLIKYLLVHRRAALEELLVSKPNQGQHL
DVLHGGFDKLLTGSISVFFEWLQKSEQVINRVLEQCAAIMWVQYIAGSAKFPGVRIKGME
DRRKKEMGRRSQDSMKLDLRHWELVSERRYALELVRDAMSTELRVIRQDKYGWVLHAESE
WQAHLQQLVHERGIFPMRKSTNIEEPEWQLCPIEGPYRMRKKLERAKLKIDTIQNVLNQQ
FELKGAGVLQQKNENGLDASETDDNSVFRLLSDRTKSKCFDGGEYDESFFMDTDDVKEGD
AASARLGWNDDQASSINEASLHSALEYGVKSSAVSVPITDIQARSDLGSPRQSSSGRNDE
LKVNEDKLDKDLYDNGEYLIRPYLEPLEKIRFRYNCERVVGLDKHDGIFLIGELSLYVIE
NFYIDDTGCICEKQFEDELSVIDQALGVKKDSGSMDFQSKSSSSWGVTVKSCVGGRAWAY
NGGAWGKEKVSSGGNLPHLWRMWNLDSIHEILKRDYQLRPVAVEIFSMDGCNDLLVFHKK
EREEVFKNLVAMNLPRNSMLDTTISGSLKQESNEGSRLFKIAAKSFSKRWQNGEISNFQY
LMHLNTLAGRGYSDLTQYPVFPWVLADYESETLDLADPKTFRKLEKPMGCQTAEGEEEFK
KRYESWDDPDVPKFHYGSHYSSAGIVLFYLLRLPPFSTENQKLQGGQFDHADRLFNSVRD
TWSSAAGKGNTSDVKELIPEFFYMPEFLENRFNLDLGEKQSGEKVGDVGLPPWAKGSARE
FIRKHREALESEYVSENLHHWIDLIFGYKQRGKAAEEAVNVFYHYTYEGSVDIDSVTDPA
MKASILAQINHFGQTPKQLFLKSHPKRRPDKKLPHHPLRHCNYLVAHEIRKTSSSITQIV
TFNDKILVAGTNNLLKPRTYSKYVAWGFPDRSLRFMNYDQDRLLSTHENLHGGNQIQCVG
VSHDGQTLVTGADDSVVCVWQISKERLRSLRRLHLQKALCAHTAKITCLYVSQPYMLIVS
GSDDCTVILWDLSGLIFVKQLPEFPAPVSAIYVNDMTGEIVTAAGILLAVWSINGDCLAV
VNTSQLPSDFILSVTSATFSDWLDTNWYVTGHQSGAVKVWHMAHCSDDVTGRNKSSPTNG
TGFGISDKAPEYRLVLHKVLKSHKHPVTALHLTSNLKQLLSGDSAGHLLSWTLPDESLRA
SFNQG
Download sequence
Identical sequences A0A2G5DNJ0
Aquca_017_00553.1|PACid:22031729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]