SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00556.2|PACid:22032153 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00556.2|PACid:22032153
Domain Number 1 Region: 59-126
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 0.0000000000196
Family Ribosomal protein L29 (L29p) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00556.2|PACid:22032153
Sequence length 143
Sequence
MFMVRVFRRTLFAAARSEPSNATAAASASTKMIHNPLEAFFEADRSQEEGKPVVYGRSWK
ASELRLKSWDDLQKLWCVLLKEKNMLMTQRQMLHAQNLRFPNPERIPKVRKSMCRIKHVL
TERAIDEPDARRSAEMKKMINAL
Download sequence
Identical sequences A0A2G5DNK0
Aquca_017_00556.1|PACid:22032154 Aquca_017_00556.2|PACid:22032153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]