SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00556.3|PACid:22032155 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_017_00556.3|PACid:22032155
Domain Number - Region: 59-98
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 0.000327
Family Ribosomal protein L29 (L29p) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00556.3|PACid:22032155
Sequence length 134
Sequence
MFMVRVFRRTLFAAARSEPSNATAAASASTKMIHNPLEAFFEADRSQEEGKPVVYGRSWK
ASELRLKSWDDLQKLWCVLLKEKNMLMTQRQMLHAQNLRFPNPERIPKVNLQLVVITIGM
CLLHKLVSKLVTST
Download sequence
Identical sequences A0A2G5DNQ8
Aquca_017_00556.3|PACid:22032155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]