SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00761.1|PACid:22031580 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00761.1|PACid:22031580
Domain Number 1 Region: 5-93
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.61e-24
Family Ribosomal protein L14e 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00761.1|PACid:22031580
Sequence length 134
Sequence
MPFKRYVEIGRVALVNYGKDYGKLVVIVDVIDQNRALVDAPDMVRSQMNFKRLSLTDIKI
DINRVPKKKSLIEAMEAADVKNKWENSSWGRKLIVQKRRASLNDFDRFKLMLAKIKKAGA
VRQELSKLKKQSAA
Download sequence
Identical sequences A0A2G5DPL0
Aquca_017_00761.1|PACid:22031580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]