SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_017_00772.1|PACid:22031453 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_017_00772.1|PACid:22031453
Domain Number 1 Region: 478-693,763-812
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000654
Family Quinoprotein alcohol dehydrogenase-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_017_00772.1|PACid:22031453
Sequence length 894
Sequence
MSSLTTLRRIKERGGSGGKVMALKPSTPKTLTPVSEKDNCVVSNRKPIGKENVRSISATR
SSTSSSQKSIIKPVPIPRIDKSAIRDGESRGGGVRWSTSSVPRVRDADYNGATNRNVAKL
GENKVNSAIQSLKDRVRFDMNVKARAEKAALGGNTTESCKQKGCSDFDSQVAVSLREAAH
GEVSSIDTSLKGLKGSALNNSKVLEKSKEKVDSEEVKPVRAGNKYSSKLHEKLAFLEGKV
KRIASDIKKTKEMLDKNNPDASKTIITDIQEKISGIEKAMGHTINDNQGSLDAPKIVKIS
DQQSNCLETSQSKQVGQLKHSVKDLNREDLEARLFPHHKLLKGRTMLKASSESIQNDQPP
QPDSSADSEQEDMVLSSIEENSIASEFLESLNEKASKCSTQNRQDSLEFHEIQEMDGPAT
TDAKGNLNPLTVRNRAGEIRLTSDETFEEFDDEQENIPESVIEEMEESCMDQLNEIGWKT
STGGWFVSEGESVLLAHDDGSCTFYDIANCEVKAEYKPPVLVTPNVLGDCWLIRAADSDG
CSGRYVVAASSGSSLDSGFCSWDFYTKEIRAFHAEGESVTSSLRTVLGPLPNRPVQKRSL
LSTIMSSENQQCWYKPCGHLIASTASSQRVVSVYDIRDGEQVMKWEMQRPVITMDYSSPL
HWRNRGKVVIAEAEAISLWDVNSLTPHALLSVASSGRKVSALHVNNTDAELGGGVRKRVN
SSDAEGHDGVFCTQDTVNVLDFRLPSGVGLKISKIGVSVQSVFSHGDSIFLGCTRGRLVV
KEQAQSCVQQFSLRKGGLVSTYALPESNAHFHYSAISQVWGNSDIVMGICGLGLFVFDAS
KDEATPSIAVDNGKSYEARDVIGPADLYSPSFDYLASRVLVISRDRPAMWRYLS
Download sequence
Identical sequences A0A2G5DPP7
Aquca_017_00772.1|PACid:22031453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]