SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_018_00031.1|PACid:22040864 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_018_00031.1|PACid:22040864
Domain Number 1 Region: 106-553
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 1.16e-172
Family Class I alpha-1;2-mannosidase, catalytic domain 0.00000000364
Further Details:      
 
Weak hits

Sequence:  Aquca_018_00031.1|PACid:22040864
Domain Number - Region: 52-96
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0628
Family Myosin rod fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_018_00031.1|PACid:22040864
Sequence length 587
Sequence
MARTSRSSSSSSSSSSHRWRYLNPSYYLKRPKRLALLFIAFVFVTFFVWDRQSLVREHED
EITKISEEVVRLQNQLQELKSLSGDVGETINASGKINESTKKNVIKDDPMDIQRRGKVKE
AMLHAWTSYEQYAWGQDELQPQTKNGVNSFGGLGATLIDSLDTLYIMGLDEQFQKAREWV
ANSLDFDKNYEASVFETTIRVVGGLLSAYDLSGDKVFLEKATDIADRLLPAWDTPSGIPF
NTINLNQGNPHNPGWTGGESILADSGTEQLEFIALSQRTGDPKYQKKVENVITEIRKNFP
ADGLLPIYINPHTGASASYSTVTFGAMGDSFYEYLLKAWIQGNKTEAVKHYREMWETSMK
GLKSLIRRTTPSSFTYICEKNGGSLNDKMDELACFAPGMLALGASGYGPGEREQFLSLAE
ELAWTCYNFYQSTPTKLAGENYFFHAGQDMNVGTSWNILRPETVESLFYLWRLTGNKTYQ
EWGWNIFQAFEKNSRVESGYVGLKDVNTGVKDNMMQSFFLAETLKYLYLLFSPSSVISFD
EWVFNTEAHPLKIVTRHDEGESSGGLVAQLKSPFRYRSRKEGRTGNK
Download sequence
Identical sequences A0A2G5DKC2
Aquca_018_00031.1|PACid:22040864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]