SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_018_00044.2|PACid:22041041 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_018_00044.2|PACid:22041041
Domain Number 1 Region: 1416-1591
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000163
Family Tropomyosin 0.0035
Further Details:      
 
Weak hits

Sequence:  Aquca_018_00044.2|PACid:22041041
Domain Number - Region: 1631-1822
Classification Level Classification E-value
Superfamily Tropomyosin 0.000785
Family Tropomyosin 0.015
Further Details:      
 
Domain Number - Region: 1189-1354
Classification Level Classification E-value
Superfamily Tropomyosin 0.00621
Family Tropomyosin 0.01
Further Details:      
 
Domain Number - Region: 472-575
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0654
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_018_00044.2|PACid:22041041
Sequence length 2639
Sequence
MDKNKNNRTDLLAVGRKKLQQFRKKKETKGKLSNKTSKSEHEGEADLEPSPVDPPASPKA
AEGEPTLPHGVNAESSKSLLPHLIDSSVVTEADSVHEPVPVQELEFEPVTLVKEGANAEC
IVEHEEVQGSSIGPSDESVVVRDELTASADLASVDSLASYGDNRDAEKGPSLSHNLLCDI
SSNKEMESQEADGLVSKQCDGRDEESHNSLKDGKSLGSGCIRLEPEGVKESVAFGYPEIA
KDTFAESQDLKETEKSTHEREFIEGDVSDISSNYKAKENYDEGSISTLSEATDEAEGMPY
MKFVVGTDGTNFRTEGTSEMDSVTVTSDENHNVVIPVSAEVISREEGILPMVTEAGTEDT
THRTEETDERIQNAGNGSDLAVTPRELESTPDADGEEKSEMLLVETLKQQLYTTIVAKDF
FHMQLAEQIELQKIFDQADNQLLNEVAKLTSILKETQDCNTSLSEELAQCRSDIQAMASG
REELETQFVSARRELSQCRSDLQAVTAGKEGLETQFAAAGKDLAQCRSDLHAMSAVREEL
ETQFASSRKEIEESTSRAFEFQTQLERSSVETANLLAELAGFRSSMEALENENAKLHANL
TAEIGSRNKLEDENKYLLFEKEKLATLHLEHQEQFSSEHDKHTQLEVDLKEAMLRLEQLT
QENLFLSSSVDIHKAKLMEIESKHSDLLSEATENRYTLEDVNIPADDEHSKQISQQLVGN
DMSDVGESVVLGSTEGIAIQPLEGQNSGDSNRFSDLMAHLDEAQKTMHKLEKAIEGMHSH
SVSLSRSSGKVAGAGVSKLIQAFELKVHHDENGPVELPLDEGERSTDDHLMLAKEQTRNL
RAVLKELDLSAVKLNDEFKDAKSSKECGSAALSELQILYEASKQQNNNLEAKTVELVEKL
SDYQSRTDAMQLQLYSMEQKSGEMESLIVNQVENMKKDLDDKLSALEQEWNFTIEEISGT
IVNLDASIGRLSTTTASTVQSDGLNFGCRVAASVNAATNVIENLDEKLGESYTSLMNVHS
SYESLNEKFYELHVTNGLAVEMLGLIYSELIRFTVSSCDDVQGSWMDVKHENKLDLLHPS
NYLYLLNRLSELLDDRLLLKSAKGKLESELNNRAQEVAELKIYCVGSETILKLVEDVKSV
VKLNDTEFDYGKPSVSHLESLIAFLVQKYREASEQAVSCREEFEVKSFEYSELQVKMAQL
SSLSSQQEDENQILKKSLSEMEGTLEALRSDLQAKGAELEQAEQRVSSLREKLSIAVAKG
KGLIVQRDGLKQSISEISSELERCSQDVQLKDTRLREVETKLKAYSEAGERIEALESELS
YIRNSATGLRESFLLKDSILQRIEEVLEDLELPEHFHSRDIIEKIEWLARSVSGNSLQMT
EWDQKSSVGGSYSDAGFAVRDGWQEETQSIHDPGFNELQRKNEELQTKFYGLAEHNEMLE
QSLVERNNLVRRWEEVLDRIEMPLQFRSMDTEERIQWLGNALTEASHDRDFLRKKIEDFE
SHCGSLEADWEQSQRKISDLEADLQGVTRERELVSESLENLSSDQEKVLEKVNQYQLEKN
NLQNEITRLQEKLVKLENDDHHVQGEIKKLQVLVTESLPDQGAEDIAHSGSGTECLEGLL
RKLIESYMALSFEKTVVEDIVREHHSGNSGVVPDIQQKNVSLQSMEKDQMSLKEELEEAL
SNFAHEKAERVKIVEHYESLALDYETLGRQRDELQEKLNQEEMKFVSTRDKLNIAVRKGK
GLVQQRDSLKQTIEDMKAEMNHLKNELSQREIALGQYEQKIRDLSIYPEKVETLERECLF
LRSHLTQMEHRMQDSGNTLSSLMNSLNAIDIGSGLNTSDPVEKMETIGRLWHELQASLTS
SEHESKKSKRATELLLAELNEVHERADSLQEELSKVEAALARISEERDLAEAARAEAFSR
LENVTTDHSDKRRKELADVMKLKAVTDQLKKGCFGFSNLIADVFSADLKLLSNVEDGMES
LFKQIDATHVVKPPLLAAPGGVLSANPAYEVTFPATDVSLDMKMQENFDDSTIDALHIVC
RVVEECTREMDTIREKCYKHTVSCDHQAKTLSKAMQDVHKELASRKESLESTKRDFTIFE
SMRKEKDTEILLMHRKIALLYKACTRSILEIDNQKAQLVRDGMLVHGKDDMNAVLPALSD
GQESIDGQTSFSEESISSIADTLLSAVKDLINIQAERTKNGQKELKVSISNLQKELQEKD
IQKNRICAELVSQIKKAEADSKNYLVDLQSSKAQVGNLEKQIEALEQERNVLELKNKELH
NGETSSLQLQERIISLNDLLSVKGQEIEDLMQALDEEELQMESLRNKIEELERISQEKNL
VVENLEVSRAKTMAKLSTTVSKFDELHQLSEGLLSEIENLQAQLQGRDAEISFLRQEVTR
CTNDVLAASQEGNKRNVTEMHNTLTWLDMMISRFGGCDVQLDNKDCSRLEACKEILEKHI
TSLFSELEALRVMAQNHDALLQIERNKTEELLHKSESLERFLHEKELMIESLQGSRDLGE
TTSVAPSEITEIEPMINKRAVAGATPQVRGLRKVNNDQVAISIDMDSGGSTLDDEDDKMH
GFKALTTSRIVPRFTRPVSNMIDGLWVSCDRALMRQPALRLVIILYWFMLHTLLATSMV
Download sequence
Identical sequences A0A2G5DJL9
Aquca_018_00044.1|PACid:22041042 Aquca_018_00044.2|PACid:22041041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]