SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_018_00044.3|PACid:22041043 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_018_00044.3|PACid:22041043
Domain Number 1 Region: 1407-1582
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000163
Family Tropomyosin 0.0035
Further Details:      
 
Weak hits

Sequence:  Aquca_018_00044.3|PACid:22041043
Domain Number - Region: 1622-1813
Classification Level Classification E-value
Superfamily Tropomyosin 0.000785
Family Tropomyosin 0.015
Further Details:      
 
Domain Number - Region: 1180-1345
Classification Level Classification E-value
Superfamily Tropomyosin 0.00621
Family Tropomyosin 0.01
Further Details:      
 
Domain Number - Region: 463-566
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0654
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_018_00044.3|PACid:22041043
Sequence length 2630
Sequence
MDKNKNNRTDLLAVGRKKLQQFRKKKETKGKLSNKTSKSEHEGEADLEPSPVDPPASPKA
AEGEPTLPHGVNAESSKSLLPHLIDSSVVTEADSVHEPVPVQELEFEPVTLVKEGANAEC
IVEHEEVQGSSIGPSDESVVVRDELTASADLASVDSLASYGDNRDAEKGPSLSHNLLCDI
SSNKEMESQCDGRDEESHNSLKDGKSLGSGCIRLEPEGVKESVAFGYPEIAKDTFAESQD
LKETEKSTHEREFIEGDVSDISSNYKAKENYDEGSISTLSEATDEAEGMPYMKFVVGTDG
TNFRTEGTSEMDSVTVTSDENHNVVIPVSAEVISREEGILPMVTEAGTEDTTHRTEETDE
RIQNAGNGSDLAVTPRELESTPDADGEEKSEMLLVETLKQQLYTTIVAKDFFHMQLAEQI
ELQKIFDQADNQLLNEVAKLTSILKETQDCNTSLSEELAQCRSDIQAMASGREELETQFV
SARRELSQCRSDLQAVTAGKEGLETQFAAAGKDLAQCRSDLHAMSAVREELETQFASSRK
EIEESTSRAFEFQTQLERSSVETANLLAELAGFRSSMEALENENAKLHANLTAEIGSRNK
LEDENKYLLFEKEKLATLHLEHQEQFSSEHDKHTQLEVDLKEAMLRLEQLTQENLFLSSS
VDIHKAKLMEIESKHSDLLSEATENRYTLEDVNIPADDEHSKQISQQLVGNDMSDVGESV
VLGSTEGIAIQPLEGQNSGDSNRFSDLMAHLDEAQKTMHKLEKAIEGMHSHSVSLSRSSG
KVAGAGVSKLIQAFELKVHHDENGPVELPLDEGERSTDDHLMLAKEQTRNLRAVLKELDL
SAVKLNDEFKDAKSSKECGSAALSELQILYEASKQQNNNLEAKTVELVEKLSDYQSRTDA
MQLQLYSMEQKSGEMESLIVNQVENMKKDLDDKLSALEQEWNFTIEEISGTIVNLDASIG
RLSTTTASTVQSDGLNFGCRVAASVNAATNVIENLDEKLGESYTSLMNVHSSYESLNEKF
YELHVTNGLAVEMLGLIYSELIRFTVSSCDDVQGSWMDVKHENKLDLLHPSNYLYLLNRL
SELLDDRLLLKSAKGKLESELNNRAQEVAELKIYCVGSETILKLVEDVKSVVKLNDTEFD
YGKPSVSHLESLIAFLVQKYREASEQAVSCREEFEVKSFEYSELQVKMAQLSSLSSQQED
ENQILKKSLSEMEGTLEALRSDLQAKGAELEQAEQRVSSLREKLSIAVAKGKGLIVQRDG
LKQSISEISSELERCSQDVQLKDTRLREVETKLKAYSEAGERIEALESELSYIRNSATGL
RESFLLKDSILQRIEEVLEDLELPEHFHSRDIIEKIEWLARSVSGNSLQMTEWDQKSSVG
GSYSDAGFAVRDGWQEETQSIHDPGFNELQRKNEELQTKFYGLAEHNEMLEQSLVERNNL
VRRWEEVLDRIEMPLQFRSMDTEERIQWLGNALTEASHDRDFLRKKIEDFESHCGSLEAD
WEQSQRKISDLEADLQGVTRERELVSESLENLSSDQEKVLEKVNQYQLEKNNLQNEITRL
QEKLVKLENDDHHVQGEIKKLQVLVTESLPDQGAEDIAHSGSGTECLEGLLRKLIESYMA
LSFEKTVVEDIVREHHSGNSGVVPDIQQKNVSLQSMEKDQMSLKEELEEALSNFAHEKAE
RVKIVEHYESLALDYETLGRQRDELQEKLNQEEMKFVSTRDKLNIAVRKGKGLVQQRDSL
KQTIEDMKAEMNHLKNELSQREIALGQYEQKIRDLSIYPEKVETLERECLFLRSHLTQME
HRMQDSGNTLSSLMNSLNAIDIGSGLNTSDPVEKMETIGRLWHELQASLTSSEHESKKSK
RATELLLAELNEVHERADSLQEELSKVEAALARISEERDLAEAARAEAFSRLENVTTDHS
DKRRKELADVMKLKAVTDQLKKGCFGFSNLIADVFSADLKLLSNVEDGMESLFKQIDATH
VVKPPLLAAPGGVLSANPAYEVTFPATDVSLDMKMQENFDDSTIDALHIVCRVVEECTRE
MDTIREKCYKHTVSCDHQAKTLSKAMQDVHKELASRKESLESTKRDFTIFESMRKEKDTE
ILLMHRKIALLYKACTRSILEIDNQKAQLVRDGMLVHGKDDMNAVLPALSDGQESIDGQT
SFSEESISSIADTLLSAVKDLINIQAERTKNGQKELKVSISNLQKELQEKDIQKNRICAE
LVSQIKKAEADSKNYLVDLQSSKAQVGNLEKQIEALEQERNVLELKNKELHNGETSSLQL
QERIISLNDLLSVKGQEIEDLMQALDEEELQMESLRNKIEELERISQEKNLVVENLEVSR
AKTMAKLSTTVSKFDELHQLSEGLLSEIENLQAQLQGRDAEISFLRQEVTRCTNDVLAAS
QEGNKRNVTEMHNTLTWLDMMISRFGGCDVQLDNKDCSRLEACKEILEKHITSLFSELEA
LRVMAQNHDALLQIERNKTEELLHKSESLERFLHEKELMIESLQGSRDLGETTSVAPSEI
TEIEPMINKRAVAGATPQVRGLRKVNNDQVAISIDMDSGGSTLDDEDDKMHGFKALTTSR
IVPRFTRPVSNMIDGLWVSCDRALMRQPALRLVIILYWFMLHTLLATSMV
Download sequence
Identical sequences A0A2G5DKE3
Aquca_018_00044.3|PACid:22041043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]