SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_018_00099.3|PACid:22040914 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_018_00099.3|PACid:22040914
Domain Number 1 Region: 112-255
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.4e-27
Family WD40-repeat 0.0011
Further Details:      
 
Weak hits

Sequence:  Aquca_018_00099.3|PACid:22040914
Domain Number - Region: 658-668,706-824
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000165
Family WD40-repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_018_00099.3|PACid:22040914
Sequence length 854
Sequence
MSFCEKEGSTRSSSPVDDGNFPCTSSQPDGISSQAPAGARRSGANVYRLLAKREICPRAK
HSSKKLWGEISDCNNIREITDAKHGLISWVESESLRHLSAKYCPLVPPPRSTIAAAFSPD
GKTLASTHGDHTVKIIDCQTGSCLKVLSGHRRTPWVVRFHPVHPEILASGSLDHEVRLWD
ANTAECIGSRDFYRPIASIAFHAQGEVLAVASGHKLYIWHYNRKEETPLPAIVLKTRRSL
RAVHFHPHAAPFLLTAEVNDLDSPDSPMTLATSPGYLHYPPPAVFFANVHSGVRPNMEPR
ATPMPFPFLFWPTFARDGGPSFQHAFMAASSSSQTVRPSAPVQLQTDPSIGSQLDYLVSP
MDIAPAIPSTSFPVPESVNNSFLSETENAVSDSAMDIMDTTEGQPIGRDYHSRSPMLDTP
DGVSNTPPLSFQPSGVGRMPSRHVRSGVEATPGIYLSTFSGNPGLQMLLRGGESSQLHQF
FPFGDPMFWELPFLQGWLMGQSQAGLHPMLSLNDALHERAPGFRGAGSDILASDFASRSM
DTTLASSIMTNGVNQSRMAGRSGLRYRSSRTRTMAGPGEGAGFINIMHDESDPQPVIGRT
ESELATSLAAAAAAELPCTVKLRVWPHDIKDPCALLDAEKCRLTIPHAVLCSEMGAHFSP
CGRFLAACVACMLPHMEAEPGLQSQVHHDVTGASTSPTRHPISAHQVMYELRIYSLEEAT
FGLVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHSSLLRSIVIDGETTVPIYTILEVY
RVSDMELVRVLPSAEDEVNVACFHPLVGGGLVYGTKEGKLRILQYDGSHGTNCAGANLNL
EENMLEVPTYALEG
Download sequence
Identical sequences A0A2G5DK21
Aquca_018_00099.2|PACid:22040915 Aquca_018_00099.3|PACid:22040914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]