SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_018_00099.4|PACid:22040916 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_018_00099.4|PACid:22040916
Domain Number 1 Region: 2-105,555-671
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000212
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_018_00099.4|PACid:22040916
Sequence length 702
Sequence
MVRFHPVHPEILASGSLDHEVRLWDANTAECIGSRDFYRPIASIAFHAQGEVLAVASGHK
LYIWHYNRKEETPLPAIVLKTRRSLRAVHFHPHAAPFLLTAEVNDLDSPDSPMTLATSPG
YLHYPPPAVFFANVHSGVRPNMEPRATPMPFPFLFWPTFARDGGPSFQHAFMAASSSSQT
VRPSAPVQLQTDPSIGSQLDYLVSPMDIAPAIPSTSFPVPESVNNSFLSETENAVSDSAM
DIMDTTEGQPIGRDYHSRSPMLDTPDGVSNTPPLSFQPSGVGRMPSRHVRSGVEATPGIY
LSTFSGNPGLQMLLRGGESSQLHQFFPFGDPMFWELPFLQGWLMGQSQAGLHPMLSLNDA
LHERAPGFRGAGSDILASDFASRSMDTTLASSIMTNGVNQSRMAGRSGLRYRSSRTRTMA
GPGEGAGFINIMHDESDPQPVIGRTESELATSLAAAAAAELPCTVKLRVWPHDIKDPCAL
LDAEKCRLTIPHAVLCSEMGAHFSPCGRFLAACVACMLPHMEAEPGLQSQVHHDVTGAST
SPTRHPISAHQVMYELRIYSLEEATFGLVLASRAIRAAHCLTSIQFSPTSEHILLAYGRR
HSSLLRSIVIDGETTVPIYTILEVYRVSDMELVRVLPSAEDEVNVACFHPLVGGGLVYGT
KEGKLRILQYDGSHGTNCAGANLNLEENMLEVNGIQRQVMIG
Download sequence
Identical sequences A0A2G5DJX0
Aquca_018_00099.4|PACid:22040916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]