SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_018_00174.2|PACid:22040969 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_018_00174.2|PACid:22040969
Domain Number 1 Region: 60-200
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.8e-44
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 987-1047
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000719
Family PB1 domain 0.029
Further Details:      
 
Weak hits

Sequence:  Aquca_018_00174.2|PACid:22040969
Domain Number - Region: 471-640
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000136
Family BAR domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_018_00174.2|PACid:22040969
Sequence length 1100
Sequence
MQKDIDAHIPNYPNLPSKLICLLLNVTLHADAETDEVYTQMTLQPVSSYDKEALLASDLA
LKSNKPQTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQELTARDLHDNA
WTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVLFIRDEKQQLLLGIRRANRQPTNIS
SSVLSSDSMHIGILAAAAHAAANNSPFNVFYNPRASPSEFVIPLAKYYKAVYNNQVSLGM
RFRMMFETEESGTRRYMGTITGISDLDPLRWKNSQWRNLQVGWDESTAGERRNRVSIWEI
EPVAAPFFICPPPFFRSKRPRQPGMPDDESADLENLFKRTMPWLGDDICIKDPQSQTAIM
PGMSLAQWMNMQQNPSLSNPAMQPDYMRSLTSPVLQNLAAADLSRQLGLIGPQALQQNNL
QFNTQRPPQQAQQLDQLPKLPTTLNQLGSLMQMQQQLDGNGLQQRQNLINQSFSGSHVQA
QAQLLQPQVQVQNNSHQQQSLVQNHQSQPNLQHNQQQQKQQQQHQQQQHLHQQQQQQQQQ
QQQQQQQQQQQQQQQQQQQLQQQQQQQQLNNAQNQHQNRIPVQHPHQVNQHLQMSEQHVQ
LLQKLQQQQQSLLSQQSPLQQHPQLTQFQEQQRQILEMPQNLSNPNSLSQQHMIQQQMMK
NNSQQGIGFSNLSQHQSPSKLQHQHSMLGELPGLVLPHEPTTNMLSTASSGLLVAAGNGG
HSVFTEDVPSCSTSPSTNCPNVVQSTINSRIHCSTVIPDEMVQSAGTLLSPSALEPVSGP
SLVKELQSKSDVKPSLPNSKTQSQGMTSQTYLHAAGQLDYLEASSSATSVCLSQNDGSLQ
QNFQLPSFNPQSMLFRETSHDGDVQVDPRNNVLFGVNIDGPLGIPFTPDPLLAKGVGSVK
DSPNHLSSGNMLTNYGNSKDVQQELSSSMVSQSFGVPDLAFNSIDSTISDSGFLNQGPWA
PPPQLQRMRTFTKVYKRGAVGRSIDIARYSGYDELKQDLARRFGIEGQLEDRQRIGWKLV
YVDHENDVLLVGDDPWEEFVNCVRCIKILSPQEVQQMSLDGDLATSVLPNQACSSSDGGN
AWRNGHCEQNSGNPSGGSYE
Download sequence
Identical sequences A0A2G5DKA0
Aquca_018_00174.2|PACid:22040969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]