SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_018_00183.1|PACid:22040938 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_018_00183.1|PACid:22040938
Domain Number 1 Region: 215-481
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.71e-72
Family BC ATP-binding domain-like 0.00000134
Further Details:      
 
Domain Number 2 Region: 129-245
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.09e-45
Family BC N-terminal domain-like 0.000031
Further Details:      
 
Domain Number 3 Region: 463-578
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 5.23e-41
Family BC C-terminal domain-like 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_018_00183.1|PACid:22040938
Sequence length 600
Sequence
MLVKQSSKLNSNSTSRRSFQSAFLLVFIDTFSINFIHFSSSHCCFSLNKFFLNFIFLQGL
RPFSSRMDSMTVCKSVSSPNVPGLCVGQSRGIRSSQCSFMLGSGVMFPRQSIQSARVTHK
SKKRGGALAATCRYDKILVANRGEIAVRIIRTAHEMGIPCVAVYSTIDKDALHVKLADEA
VCIGEAPSNQSYLVMPNVLSAALSRKCTMLHPGYGFLAENATFVEMCREHRINFIGPNPD
SIRTMGDKATARDTMKKAGVPTVPGSEGLLQTTEEAIRLADEIGYPVMIKATAGGGGRGM
RLAKEPEEFVKLLQQAKSEAAAAFGNDGVYLEKYIQNPRHIEFQVLADRYNNAIHFGERD
CSIQRRNQKLLEEAPSPALTPELRKAMGDAAVAAATSIGYIGVGTVEFLLDERGAFYFME
MNTRIQVEHPVTEMISSVDLIEEQIRVARGEKLRYTQDDIVLRGHSIECRINAEDAFKGF
RPGPGRITAYLPSGGPFVRMDSHIYPDYVVPPSYDSLLGKLIVWAPTRERAIERMKRALS
DTIITGVPTTIEYHKLILEIEDFKNGNVDTAFIPKHEKELAEPQKIVLSTPAKELTSATA
Download sequence
Identical sequences A0A2G5DKA6
Aquca_018_00183.1|PACid:22040938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]