SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_018_00204.1|PACid:22041171 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_018_00204.1|PACid:22041171
Domain Number 1 Region: 108-250,290-428
Classification Level Classification E-value
Superfamily Pseudouridine synthase 5.04e-45
Family Pseudouridine synthase I TruA 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_018_00204.1|PACid:22041171
Sequence length 435
Sequence
MMMMDHDNQTKENKKNKVHLHYNHTDFCNSSRWTARECYDFMYERPWQQVNDFYSRLVIG
GLSLSLSSSLLFQDEKVLSCVNEITEACEENELVGVSMKGRRTGRWDRVTFKILLSYHGN
SFDGWQKQPGLNTVQGIVERSVGSFVDEKKAQKLKDLGLPLEGCTVVAGRTDKGVTALKQ
VCSFYTWRKDVKAQDVEDSINEAAPGKLRVISASKVSRDFHPNFSAKWRHYFYIFPLNDE
GEELCSELGVEDENRCSKEKYREWINGSVTHLGEEKGEYLEYDDTAASGKKPRTFSIHKV
NQLLLPLQGRSLSYKMFARDTKASRSTGPPTECIIYHARAAEASLPCDNEVCGKGGKRLK
VMCVELVANRFLRRMVRVLVATLIREAAAGADNDALLKLMDATCRRATAPPAPPDGLCLV
DVGYKEFNPENCIIP
Download sequence
Identical sequences A0A2G5DKG2
Aquca_018_00204.1|PACid:22041171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]