SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_019_00013.1|PACid:22055590 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_019_00013.1|PACid:22055590
Domain Number 1 Region: 77-212
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000107
Family alpha-D-mannose-specific plant lectins 0.0061
Further Details:      
 
Weak hits

Sequence:  Aquca_019_00013.1|PACid:22055590
Domain Number - Region: 364-402
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00334
Family Anti-platelet protein 0.078
Further Details:      
 
Domain Number - Region: 226-283
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00419
Family alpha-D-mannose-specific plant lectins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_019_00013.1|PACid:22055590
Sequence length 494
Sequence
MKTPTESTRPIHYLVVLIFSFLLYMNKFLQVKATTQQVLSKGFSATPDSSVSSFQSLLND
PTGNFSLGFLRVNRSQLSLVILHVSSSETIWLANTTSSIKWSKPSKLFFNGSLVLSDHHK
RVIWSTQSNGDSVILLNNSNLQIQKLEEQSSSIHTVLWQSFDFPSDTLVENQNFTVQMSL
VSSNGLYSMRLGDDYLGLYTYFDQDSNQIYWKHRAMEAKAEIVEGQGPIYAQISSNGFLG
MYQKEQAPVDVLPFDSFQKPVSGIRRLRLESDGNVKAYYWNGLNWITDYTAISKVCELPN
SCGHYGLCRPGNGCQCLDNKTEYQSGECFSPESGDLCRERLSINKGYWILRRTGVELPYK
ELMKFEKMGTLDECEGSCEKNCSCWGALFNNVSGYCYFIDYPINTLVGVGDENKLGYFKV
RRIAEKKRNVGYAIGVGLLVGALVIFVGFALFGIYTIWRRKKRMNCGFMEDGVSPGPYSD
LGSSSFRSVELCKS
Download sequence
Identical sequences A0A2G5DIL6
Aquca_019_00013.1|PACid:22055590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]