SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_019_00028.1|PACid:22055656 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_019_00028.1|PACid:22055656
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.26e-16
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 146-244
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000106
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_019_00028.1|PACid:22055656
Sequence length 259
Sequence
MQGIPKKFLTRYGKYMSNDVVLKVCGCMAWRVELRKADGFACFQNGWKEFVEHYSICAGH
YLVFRYNRKSQFGVIIFGLSGNEIDYSRSSNNLGEFNHAKHAPLPENEGGDGNNGDDSSG
RDLMTRRLVKTEERKVAIQITSPFMSKYPFFKITMQPSYVNARYWLIPRIFSDKYLPEGL
ESLSHQVPNGKNKWVVGCYLYRGTDLRMSKGLSLFMLENNIQIGDVCYFELIKKKNVVLK
VSVIGRVVQSIKTEVGGVT
Download sequence
Identical sequences A0A2G5DIM1
Aquca_019_00028.1|PACid:22055656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]