SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_019_00049.1|PACid:22055603 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_019_00049.1|PACid:22055603
Domain Number 1 Region: 240-469
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 6.67e-89
Family CAT-like 0.000000111
Further Details:      
 
Domain Number 2 Region: 97-189
Classification Level Classification E-value
Superfamily Single hybrid motif 3.27e-24
Family Biotinyl/lipoyl-carrier proteins and domains 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_019_00049.1|PACid:22055603
Sequence length 470
Sequence
MWGIVRRKVGSDASSYLGQSIKRIRPAVSAPRTYMSQSKETLLVRRGSKYIQSFSSNILP
GSAVSTKPLSDFVAFSQKNSSIQAWGRSFSSDSGDLVDAVVPFMGESITDGTLAKFLKKP
GDSVAVDEPIAQVETDKVTIDVASPEAGVIQKFVASEGDTVEPGTKIAVISKSAEGASHV
APSEEKTAKAAPQPSPPAEKDDVDKKIPKSEEVVKEKPKAPSPSPKATSASEPILPPKDR
ERRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSDYKDAFLEKHGVKLGLM
SGFVKAAVTGLQNQPIINAVIDGDDIIYRDYVDISIAVGTPKGLVVPVIRNADRMNFADI
EKEINNLAKKATAGTISIDEMAGGSFTISNGGVYGSLLSTPIINPPQSAILGMHSIVSRP
MVVGGNVVPRPMMYIALTYDHRLIDGREAVFFLRRIKDVVEDPRRLLLDI
Download sequence
Identical sequences A0A2G5DIN6
Aquca_019_00049.1|PACid:22055603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]