SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_019_00085.1|PACid:22055465 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_019_00085.1|PACid:22055465
Domain Number 1 Region: 53-364
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-86
Family Protein kinases, catalytic subunit 0.00000031
Further Details:      
 
Domain Number 2 Region: 335-355,400-516
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-23
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_019_00085.1|PACid:22055465
Sequence length 517
Sequence
MLVLVGDNNNNNITYTISTQQQQQQQGDSSLSSMEKDFDSKLRLQNNNSNKIPVQRAKSF
AFRAPQENFTINDFQLGKIYGVGSYSKVVRAKKKDTGKVYALKIMDKKFITKENKTSYVK
LERVVLDQLDHPGIVRLFFTFQDSFSLYMALESCEGGELFDQITRKGRLSEDEARFYAAE
VIDALEYIHGVGLIHRDIKPENLLLTAEGHIKIADFGSIKPMKDSRITFLPSLASDEKAC
TFVGTAAYVPPEVLNSSPPTFGNDLWALGCTLYQMLSGSSPFKDASEWLIFQKIIARDLR
FPDYFSEEARDLIDKLLDTDPSKRPGAGPDGYAALKKHPFFEHIDWDRLRMISPPKLVLD
PNATEADDVQNSGWNLSHVGDGSGRYTDASSGATSSSDSYAHVTRLASIDSFDSRWQKFL
DPGEAIVMISTLKKVNKLSSKKVQLILTDKPKLICIDPAKLMLKGNIIWSDNPNDLSIQV
ISSSHFKLCTPKKVRSFEDAKQRAWQWKKAIEGLQNR
Download sequence
Identical sequences A0A2G5DIW3
Aquca_019_00085.1|PACid:22055465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]